- Adrenomedullin R/ADMR/GPR182 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90231
- Human
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: LSPHFRGRLL NAVVHYLPKD QTKAGTCASS SSCSTQHSII ITKGDSQPAA AAPHPEPSLS FQAHHLLPNT SPISPTQPLT PS
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Adrenomedullin R/ADMR/GPR182
- Unconjugated
- Rabbit
- 7TMR, ADMR, AM-R, AMR, G10D, L1-R, gamrh, hrhAMR
- G protein-coupled receptor 182
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Specifications/Features
Available conjugates: Unconjugated